PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G17650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 359aa    MW: 38616.8 Da    PI: 6.1037
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G17650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.5e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l + + ++G g+W+++++  g+ R++k+c++rw +yl
  OMERI01G17650.1 16 RGLWSPEEDEKLFNHISRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 63
                     788*******************************************97 PP

2Myb_DNA-binding51.52.3e-1669112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el++ ++k lG++ W+ Ia+ ++ gRt++++k++w++
  OMERI01G17650.1  69 RGSFSQQEEELIISLHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 112
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-24866IPR009057Homeodomain-like
PROSITE profilePS5129418.8451163IPR017930Myb domain
SuperFamilySSF466892.25E-2913110IPR009057Homeodomain-like
SMARTSM007173.0E-131565IPR001005SANT/Myb domain
PfamPF002492.2E-141663IPR001005SANT/Myb domain
CDDcd001678.00E-121963No hitNo description
PROSITE profilePS5129425.97264118IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2667118IPR009057Homeodomain-like
SMARTSM007175.4E-1668116IPR001005SANT/Myb domain
PfamPF002491.0E-1469113IPR001005SANT/Myb domain
CDDcd001671.42E-1171111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRESAACSP KPKLRRGLWS PEEDEKLFNH ISRYGVGCWS SVPKLAGLER CGKSCRLRWI  60
NYLRPDLKRG SFSQQEEELI ISLHKILGNR WSQIASQLPG RTDNEIKNFW NSCLKKKLRQ  120
RGIDPATHKP LNDGGAGAGE EHHDGDKQQQ QLMDDVDDCF AIGGGGGSSD SLAPPHSPAV  180
SFDPLSVTNV PTTMMQSSSS PYGAAGGEHS SFRSDTLCDY GGSGGGGGVD VVSDAGTYSV  240
YTGDSSSNSN STAWTCGSVV VGGAGELPPP PLLPHMDMFG RVDAEPPPYP PFDVPARFSP  300
WHHHHHHHEP TLPTPPQRLD GGGGAAASFP IRSLSRDMPE SCFDLGRGAL DDEFGVDFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-32121183108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113119LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643158.10.0PREDICTED: myb-related protein Hv33
TrEMBLA0A0E0C3D30.0A0A0E0C3D3_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g36460.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-75myb domain protein 86